.
The Open Protein Structure Annotation Network
PDB Keyword
.

2zcw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Global gene expression mediated by Thermus thermophilus SdrP, a CRP/FNR family transcriptional regulator. Mol.Microbiol. 70 60-75 2008
    Site RSGI
    PDB Id 2zcw Target Id ttk003001019.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14508, Molecular Weight 22316.24 Da.
    Residues 202 Isoelectric Point 5.43
    Sequence mtqvretvsfkagdvilypgvpgprdrayrvleglvrleavdeegnaltlrlvrpggffgeealfgqer iyfaeaatdvrleplpenpdpellkdlaqhlsqglaeayrrierlatqrlknrmaaallelsetplahe eegkvvlkathdelaaavgsvretvtkvigelaregyirsgygkiqlldlkglkelaesrgqgr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.232
    Matthews' coefficent 2.41 Rfactor 0.221
    Waters 141 Solvent Content 48.93

    Ligand Information
    Ligands MPD ((4S)-2-METHYL-2,4-PENTANEDIOL) x 3
    Metals

    Jmol

     
    Google Scholar output for 2zcw

    Protein Summary

    2zcw structure is related to 3dv8 and 1o5l.

    For more detail, check reference [Ref]

    Ligand Summary

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch