.
The Open Protein Structure Annotation Network
PDB Keyword
.

2zcf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Mutational study on alphaGln90 of Fe-type nitrile hydratase from Rhodococcus sp. N771. Biosci.Biotechnol.Biochem. 70 881-889 2006
    Site RSGI
    PDB Id 2zcf Target Id ar_001000506.7
    Molecular Characteristics
    Source Rhodococcus erythropolis
    Alias Ids TPS12181, Molecular Weight 24328.34 Da.
    Residues 219 Isoelectric Point 5.00
    Sequence svtidhttenaapaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtprrg aelvarawtdpefrqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpilglppt wyksfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlqeivtkdc ligvaipqvptv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.43 Rfree 0.2111
    Matthews' coefficent 2.57 Rfactor 0.1694
    Waters 655 Solvent Content 51.28

    Ligand Information
    Ligands
    Metals FE (FE) x 1;MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 2zcf

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch