The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of a CRISPR-associated protein, Cse2, from Thermus thermophilus HB8. Proteins 73 1063-1067 2008
    Site RSGI
    PDB Id 2zca Target Id ttk003002109.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS24600, Molecular Weight 19598.21 Da.
    Residues 171 Isoelectric Point 9.18
    Sequence ghmspgerfldwlkrlqgqkawtaaraafrrslafppgayprampyvepflakgdwrqeereahylvaa lyalkdgdhqvgrtlaralwekaqgsasvekrflalleadrdqiafrlrqavalveggidfarllddll rwfsperhvqarwareyygagaseeekkkevea
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.215
    Matthews' coefficent 2.30 Rfactor 0.186
    Waters 240 Solvent Content 46.49

    Ligand Information


    Google Scholar output for 2zca

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch