.
The Open Protein Structure Annotation Network
PDB Keyword
.

2zbw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of thioredoxin reductase-like protein from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2zbw Target Id ttk003000395.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14360, Molecular Weight 36204.56 Da.
    Residues 335 Isoelectric Point 6.41
    Sequence maadhtdvlivgagptglfagfyvgmrglsfrfvdplpepggqltalypekyiydvagfpkvyakdlvk glveqvapfnpvyslgeraetleregdlfkvttsqgnaytakaviiaagvgafeprrigapgerefegr gvyyavkskaefqgkrvlivgggdsavdwalnlldtarritlihrrpqfraheasvkelmkaheegrle vltpyelrrvegdervrwavvfhnqtqeelalevdavlilagyitklgplanwglaleknkikvdttma tsipgvyacgdivtypgklplivlgfgeaaiaanhaaayanpalkvnpghssekaapgt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.259
    Matthews' coefficent 2.40 Rfactor 0.22
    Waters 255 Solvent Content 48.70

    Ligand Information
    Ligands FAD (FLAVIN-ADENINE) x 2
    Metals

    Jmol

     
    Google Scholar output for 2zbw

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch