.
The Open Protein Structure Annotation Network
PDB Keyword
.

2zbp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of ribosomal protein L11 methyltransferase from Thermus thermophilus. To be Published
    Site RSGI
    PDB Id 2zbp Target Id ttk003000836.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14448, Molecular Weight 27629.31 Da.
    Residues 254 Isoelectric Point 5.08
    Sequence mwvyrlkgtlealdpilpglfdggarglweregevwaffpapvdlpyegvweevgdedwleawrrdlkp alappfvvlapwhtwegaeiplviepgmafgtghhettrlalkalarhlrpgdkvldlgtgsgvlaiaa eklggkalgvdidpmvlpqaeanakrngvrprflegsleaalpfgpfdllvanlyaelhaalapryrea lvpggralltgilkdraplvreamagagfrpleeaaegewvllaygr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.246
    Matthews' coefficent 2.66 Rfactor 0.209
    Waters 122 Solvent Content 53.80

    Ligand Information
    Ligands SAM (S-ADENOSYLMETHIONINE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2zbp

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch