The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of GDP-D-Mannose Dehydratase from Aquifex aeolicus VF5. To be Published
    Site RSGI
    PDB Id 2z95 Target Id aae001001082.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12056, Molecular Weight 39336.17 Da.
    Residues 345 Isoelectric Point 5.44
    Sequence msgkralitgirgqdgaylaklllekgyevygadrrsgefaswrlkelgiendvkiihmdllefsniir tiekvqpdevynlaaqsfvgvsfeqpiltaevdaigvlrilealrtvkpdtkfyqastsemfgkvqeip qtektpfyprspyavaklfghwitvnyreaynmfacsgilfnhesplrgiefvtrkityslarikyglq dklvlgnlnakrdwgyapeyveamwlmmqqpepddyviatgethtvrefvekaakiagfdiewvgegin ekgidrntgkvivevseeffrpaevdilvgnpekamkklgwkprttfdelveimmeadlkrvrdrevsv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.60 Rfree 0.253
    Matthews' coefficent 2.41 Rfactor 0.200
    Waters 271 Solvent Content 48.89

    Ligand Information


    Google Scholar output for 2z95

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch