.
The Open Protein Structure Annotation Network
PDB Keyword
.

2z4g

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Monofunctional Histidinol Phosphate Phosphatase from Thermus thermophilus HB8. Biochemistry 46 12618-12627 2007
    Site RSGI
    PDB Id 2z4g Target Id ttk003000063.3
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS23798, Molecular Weight 29974.50 Da.
    Residues 267 Isoelectric Point 5.62
    Sequence mvdshvhtplcghaeghpeayleearakglkgvvftdhspmppwydpesrmrlealpfyllalervrer aqdlyvgigleadfhpgtegflaqllrrypfdyvigsvhylgawpldhpdhqeeyawrdlkevfrayfq evekaarsglfhaighldlpkkfghrlpeeallelaepalravaeaglfldvntaglrrpakevypapa llrrarelgiglvlgsdahrpeevgfafpevqallaglgfreayyfvegspvayplsras
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.268
    Matthews' coefficent 2.56 Rfactor 0.224
    Waters 413 Solvent Content 51.89

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals FE (FE) x 4;ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 2z4g

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch