The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of 5'-nucleotidase precursor from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2z1a Target Id ttk003000132.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14241, Molecular Weight 59966.99 Da.
    Residues 552 Isoelectric Point 8.64
    Sequence mkrrevlqagmalgglaglgralaqggftltlvhtndthahlepveltlsgektpvggvarrvalfdrv waraknplfldagdvfqgtlyfnqyrgladryfmhrlryramalgnhefdlgpgpladflkgarfkvvs anvdasreprlkglfapyavvvvggervgiiglttpdtreisnpgptvafldpyesaqkavyellakgv nkivvlshlgygedlklarrlvgvqvivgghshtllgsfphkelspagpyptvvknpegkdvlvvqawe wgkvvgllevtfdakgellaykgeallmtpeaapedffakeallayaqpvmalmqqviaeakvdlvger avvrrresnlgnlitdgmlwktrnagtqialqngggirasipkgpitvgkvyevlpfgntlvvmdlkgk eilaalengvsqwentagrflqvsglryafdlsrpagsrvvrvevktekgyvpldleatyrvvvnnfia nggdgftvlkeaqgyrvdtgfsdaesfmdylkelkvveaglegrievlnepkgerpayfayrvpglvgv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.75 Rfree 0.209
    Matthews' coefficent 2.10 Rfactor 0.179
    Waters 587 Solvent Content 41.53

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1;THM (THYMIDINE) x 1
    Metals ZN (ZINC) x 2


    Google Scholar output for 2z1a

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch