.
The Open Protein Structure Annotation Network
PDB Keyword
.

2z16

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Matrix protein 1 from influenza A virus A/crow/Kyoto/T1/2004(H5N1). To be Published
    Site RSGI
    PDB Id 2z16 Target Id ar_001000435.1
    Molecular Characteristics
    Source Influenza a virus
    Alias Ids TPS12157, Molecular Weight 17356.24 Da.
    Residues 158 Isoelectric Point 8.45
    Sequence mslltevetyvlsiipsgplkaeiaqkledvfagkntdlealmewlktrpilspltkgilgfvftltvp serglqrrrfvqnalngngdpnnmdravklykklkreitfhgakevalsystgalascmgliynrmgtv ttevafglvcatceqiadsq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.02 Rfree 0.23030
    Matthews' coefficent 1.89 Rfactor 0.20101
    Waters 124 Solvent Content 34.83

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2z16

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch