The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of human Tob1 protein. To be Published
    Site RSGI
    PDB Id 2z15 Target Id hsi002022719.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12552, Molecular Weight 13625.92 Da.
    Residues 117 Isoelectric Point 5.41
    Sequence mqleiqvalnfiisylynklprrrvnifgeelerllkkkyeghwypekpykgsgfrcihigekvdpvie qaskesgldiddvrgnlpqdlsvwidpfevsyqigekgpvkvlyvddn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.30 Rfree 0.246
    Matthews' coefficent 2.85 Rfactor 0.194
    Waters 456 Solvent Content 56.79

    Ligand Information


    Google Scholar output for 2z15

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch