.
The Open Protein Structure Annotation Network
PDB Keyword
.

2z11

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative acetyltransferase. To be Published
    Site RSGI
    PDB Id 2z11 Target Id ttk003001865.4
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14814, Molecular Weight 22027.25 Da.
    Residues 193 Isoelectric Point 9.59
    Sequence mwafperfegrhvrleplalahlpaflrhydpevyrflsrapvapteealrahlegllgepgrvnwail fgkevagrisviapepehaklelgtmlfkpfwgspankeakylllrhafevlraervqfkvdlrnersq ralealgavregvlrknrrlpdgafrddvvysvlkeewpgvkarlearlygasgn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.15 Rfree 0.232
    Matthews' coefficent 3.23 Rfactor 0.204
    Waters 122 Solvent Content 61.93

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2z11

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch