The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Genetic Encoding of 3-Iodo-l-Tyrosine in Escherichia coli for Single-Wavelength Anomalous Dispersion Phasing in Protein Crystallography. Structure 17 335-344 2009
    Site RSGI
    PDB Id 2z10 Target Id ttk003001865.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14812, Molecular Weight 22027.25 Da.
    Residues 193 Isoelectric Point 9.59
    Sequence mwafperfegrhvrleplalahlpaflrhydpevyrflsrapvapteealrahlegllgepgrvnwail fgkevagrisviapepehaklelgtmlfkpfwgspankeakylllrhafevlraervqfkvdlrnersq ralealgavregvlrknrrlpdgafrddvvysvlkeewpgvkarlearlygasgn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.77 Rfree 0.237
    Matthews' coefficent 3.28 Rfactor 0.206
    Waters 184 Solvent Content 62.46

    Ligand Information


    Google Scholar output for 2z10

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch