.
The Open Protein Structure Annotation Network
PDB Keyword
.

2z0z

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Genetic Encoding of 3-Iodo-l-Tyrosine in Escherichia coli for Single-Wavelength Anomalous Dispersion Phasing in Protein Crystallography. Structure 17 335-344 2009
    Site RSGI
    PDB Id 2z0z Target Id ttk003001865.3
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14813, Molecular Weight 22027.25 Da.
    Residues 193 Isoelectric Point 9.59
    Sequence mwafperfegrhvrleplalahlpaflrhydpevyrflsrapvapteealrahlegllgepgrvnwail fgkevagrisviapepehaklelgtmlfkpfwgspankeakylllrhafevlraervqfkvdlrnersq ralealgavregvlrknrrlpdgafrddvvysvlkeewpgvkarlearlygasgn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.191
    Matthews' coefficent 3.30 Rfactor 0.17
    Waters 333 Solvent Content 62.71

    Ligand Information
    Ligands SO4 (SULFATE) x 6
    Metals

    Jmol

     
    Google Scholar output for 2z0z

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch