.
The Open Protein Structure Annotation Network
PDB Keyword
.

2z0x

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of ProX-CysSA complex from T. thermophilus. To be Published
    Site RSGI
    PDB Id 2z0x Target Id ttk003001048.5
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14518, Molecular Weight 16554.14 Da.
    Residues 158 Isoelectric Point 9.00
    Sequence mslspsarrvqgaletrgfghlkvvelpastrtakeaaqavgaevgqivkslvfvgekgaylflvsgkn rldlgkatrlvggplrqatpeevreltgfaiggvppvghntplpayldedllgypevwaaggtpralfr atpkellaltgaqvadlkeg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.64 Rfree 0.186
    Matthews' coefficent 1.97 Rfactor 0.158
    Waters 255 Solvent Content 37.46

    Ligand Information
    Ligands 5CA (5'-O-(N-(L-CYSTEINYL)-SULFAMOYL)ADENOSINE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2z0x

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch