.
The Open Protein Structure Annotation Network
PDB Keyword
.

2z0u

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of C2 domain of KIBRA protein. To be Published
    Site RSGI
    PDB Id 2z0u Target Id hsk002100848.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12735, Molecular Weight 16509.80 Da.
    Residues 148 Isoelectric Point 5.38
    Sequence vqrlgaseaaafdsdeseavgatriqialkydeknkqfailiiqlsnlsallqqqdqkvnirvavlpcs esttclfrtrpldasdtlvfnevfwvsmsypalhqktlrvdvcttdrshleeclggaqislaevcrsge rstrwynlls
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.274
    Matthews' coefficent 2.11 Rfactor 0.22
    Waters 118 Solvent Content 41.73

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2z0u

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch