The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of APPL1-BAR-PH domain. To be Published
    Site RSGI
    PDB Id 2z0o Target Id hso003007272.3
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13105, Molecular Weight 44102.47 Da.
    Residues 385 Isoelectric Point 5.02
    Sequence mpgidklpieetledspqtrsllgvfeedataisnymnqlyqamhriydaqnelsaathltskllkeye kqrfplggddevmsstlqqfskvidelsschavlstqladammfpitqfkerdlkeiltlkevfqiasn dhdaainrysrlskkrendkvkyevtedvytsrkkqhqtmmhyfcalntlqykkkiallepllgymqaq isffkmgsenlneqleeflanigtsvqnvrremdsdietmqqtiedlevasdplyvpdpdptkfpvnrn ltrkagylnarnktglvsstwdrqfyftqggnlmsqargdvagglamdidncsvmavdcedrrycfqit sfdgkkssilqaeskkdheewictinniskqiylsenpee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.58 Rfree 0.299
    Matthews' coefficent 2.35 Rfactor 0.235
    Waters 69 Solvent Content 47.68

    Ligand Information


    Google Scholar output for 2z0o

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch