The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of uncharacterized conserved protein from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2z0j Target Id ttk003001744.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14786, Molecular Weight 24736.95 Da.
    Residues 237 Isoelectric Point 5.47
    Sequence mrlrvdvipgehlaypdvvlvvdviratttaaafleagaealywtpslesalafkdedvvlagetgglk pprfdlgnsprealsaqvagrvvvmsttngtkaahaaartakhvllaslynahaaarlarelateevai lcagkegraglddlytagvlaeylgflgevepedgarvalavkraypdplealslsaaalalkqvglea dvpfcaqvaksaavpvlrgrvgealifkra
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 1.50 Rfree 0.211
    Matthews' coefficent 2.57 Rfactor 0.188
    Waters 1120 Solvent Content 52.22

    Ligand Information
    Metals CA (CALCIUM) x 9


    Google Scholar output for 2z0j

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch