The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative phosphoglucomutase from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2z0f Target Id ttk003000461.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14372, Molecular Weight 56245.86 Da.
    Residues 524 Isoelectric Point 6.08
    Sequence meitrlltlyyeatpdpqnplegvrfgtsghrgsslkatfteahvlaiaqaiaelrpsfgatgplflak dthalsepawatalsvfaahgievrveadgdytptplvslailehnahheakadgvlltpshnppedgg fkynpptggpanaritraieeranallqeglkgvkrlplrealarakpfdyaglyvekvaeavdleair asglrigvdplggaslrvwerlaeshglplevvnptldptfrfmpkdhdgkirmdcsspyamagllalk drfdlaigndpdadrhgivtprglmnpnhylaaalhhlyttrswpgakvgktavtsalldrvaqalgre vyetpvgfkhfvagllegwlgfageesagasflrfdgrpfstdkdgilmgllaaelmakrgqapdalye alaeklgrpyyarkdlpvspeakarlarlsakevhpstlagepvlqvldratgngeplggikvvaanaw favrpsgtedvakvyaesflgeahlervleeatallhkala
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.52 Rfree 0.257
    Matthews' coefficent 2.85 Rfactor 0.206
    Waters 312 Solvent Content 56.84

    Ligand Information


    Google Scholar output for 2z0f

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch