.
The Open Protein Structure Annotation Network
PDB Keyword
.

2z09

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of uncharacterized conserved protein from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2z09 Target Id ttk003001817.3
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14802, Molecular Weight 14756.15 Da.
    Residues 137 Isoelectric Point 5.27
    Sequence mfktillaydgseharraaevakaeaeahgarlivvhayepvpdylgepffeealrrrleraegvleea raltgvpkedalllegvpaeailqaaraekadlivmgtrglgalgslflgsqsqrvvaeapcpvllvr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.65 Rfree 0.249
    Matthews' coefficent 1.89 Rfactor 0.210
    Waters 86 Solvent Content 34.96

    Ligand Information
    Ligands ACP (PHOSPHOMETHYLPHOSPHONIC) x 1
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 2z09

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch