The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of uncharacterized conserved protein from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2z07 Target Id ttk003001315.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14682, Molecular Weight 48777.74 Da.
    Residues 420 Isoelectric Point 5.87
    Sequence maplrtkavevlqrnsrgaftvpahglypyqwlwdsafialgwtqvdwerawqellclfdygqgpdgml phivfheqsrdyfpgpdvwgrearaqpatsgitqppvvatvvrylyekdpdrdrarerarylfpkllaf hrwlyhardpyrtglvvivhpwesgmdnspawdkplsrvpvenlppyerrdvkhvnpeerprkedydry lsllylfrrleydpreiyrqspfkvvdvgfnailqranrdlyalavllqedpyeieewivrgevgleal wdreagfyfswdlvagepiavktsagflplfagtphqgrasllaqeaerwgekaryllpsvdptspffe pgrywrgpvwinvnwmvaegfrdygfaalaarlkadalalmeregfreyydpltgqgrggegfswsaal alfwtr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.233
    Matthews' coefficent 2.18 Rfactor 0.189
    Waters 337 Solvent Content 43.63

    Ligand Information


    Google Scholar output for 2z07

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch