The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site RSGI
    PDB Id 2z03 Target Id aae001001907.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12085, Molecular Weight 20308.63 Da.
    Residues 183 Isoelectric Point 6.64
    Sequence mlmlereklarlikkrslkvadepvfklssgklsryyvdlkqitfdpegdyligkamyelvkefnpdac ggltlgadpiayaiafvslmdsnpikpfvvrkepkghgmkrqiegllnpgervavledvvttgssalka vkacreyglevigvfavvdreeggreniekegiplyslfklsell
      BLAST   FFAS

    Structure Determination
    Method Chains
    Resolution (Å) Rfree
    Matthews' coefficent Rfactor
    Waters Solvent Content

    Ligand Information


    Google Scholar output for 2z03

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch