.
The Open Protein Structure Annotation Network
PDB Keyword
.

2z02

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of phosphoribosylaminoimidazolesuccinocarboxamide synthase from Methanocaldococcus jannaschii. To be Published
    Site RSGI
    PDB Id 2z02 Target Id mja001001592.2
    Molecular Characteristics
    Source Methanocaldococcus jannaschii
    Alias Ids TPS13383, Molecular Weight 27759.69 Da.
    Residues 242 Isoelectric Point 5.20
    Sequence meikleeilkkqplysgkaksiyeidddkvliefrdditagngakhdvkqgkgylnalissklfealee ngvkthyikyieprymiakkveiipievivrniaagslcrrypfeegkelpfpivqfdykndeygdpml nediavalglatreelnkikeialkvnevlkklfdekgiilvdfkieigkdregnllvadeispdtmrl wdketrdvldkdvfrkdlgdviakyrivaerlgll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.03 Rfree 0.217
    Matthews' coefficent 2.58 Rfactor 0.207
    Waters 299 Solvent Content 52.33

    Ligand Information
    Ligands ATP (ADENOSINE-5'-TRIPHOSPHATE) x 2;SO4 (SULFATE) x 3;CIT (CITRIC) x 1
    Metals

    Jmol

     
    Google Scholar output for 2z02

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch