.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yzt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of uncharacterized protein TTHA1756 from Thermus thermophilus HB8: Structural variety in UPF0150 family proteins. Proteins 71 2097-2101 2008
    Site RSGI
    PDB Id 2yzt Target Id ttk003001759.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14788, Molecular Weight 7732.28 Da.
    Residues 67 Isoelectric Point 4.84
    Sequence mrrryrvvverdeegyfvahvpelhahtqaqsfeellrrlqeaiavsleeeraevvglegaleieaa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.271
    Matthews' coefficent 2.18 Rfactor 0.242
    Waters 33 Solvent Content 43.62

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2yzt

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch