.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yzq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of uncharacterized conserved protein from Pyrococcus horikoshii. To be Published
    Site RSGI
    PDB Id 2yzq Target Id pho001001780.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS14004, Molecular Weight 31904.94 Da.
    Residues 282 Isoelectric Point 8.95
    Sequence mrvktimtqnpvtitlpatrnyalelfkkykvrsfpvvnkegklvgiisvkrilvnpdeeqlamlvkrd vpvvkendtlkkaaklmleydyrrvvvvdskgkpvgiltvgdiirryfaksekykgveiepyyqryvsi vwegtplkaalkalllsnsmalpvvdsegnlvgivdetdllrdseivrimkstelaasseeewileshp tllfekfelqlpnkpvaeimtrdvivatphmtvhevalkmakysieqlpvirgegdliglirdfdllkv lvkska
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.63 Rfree 0.243
    Matthews' coefficent 2.50 Rfactor 0.225
    Waters 345 Solvent Content 50.88

    Ligand Information
    Ligands SAM (S-ADENOSYLMETHIONINE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2yzq

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch