.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yzo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of uncharacterized conserved protein from Thermotoga maritima. To be Published
    Site RSGI
    PDB Id 2yzo Target Id tma001000797.1
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS14077, Molecular Weight 24855.33 Da.
    Residues 227 Isoelectric Point 6.36
    Sequence mvdvvmapcspvecrtavvidvlratstivtalsngasgvipvktieealekkkegvlicgernaqkpk gfnlgnspleyrkekisgktivltttngtqviekirseeiiaasflnlsavveylkskedillvcagtn grfsledfllagaivkrlkrndlgdgahaaeryfesventreeikkhsshakrlislgfendiefctte dlfktvpalvngvfilkefp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.85 Rfree 0.251
    Matthews' coefficent 2.15 Rfactor 0.221
    Waters 94 Solvent Content 42.91

    Ligand Information
    Ligands DMR (2-HYDROXY-SUCCINIC) x 2
    Metals

    Jmol

     
    Google Scholar output for 2yzo

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch