.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yzk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of orotate phosphoribosyltransferase from Aeropyrum pernix. To be Published
    Site RSGI
    PDB Id 2yzk Target Id ape001002349.1
    Molecular Characteristics
    Source Aeropyrum pernix
    Alias Ids TPS12118, Molecular Weight 18741.75 Da.
    Residues 178 Isoelectric Point 9.78
    Sequence mlakvlkkrgavlrgdfvlssgrrssvyidmrrllgdessysvaldlllevggqdlarssavigvatgg lpwaamlalrlskplgyvrperkghgtlsqvegdppkgrvvvvddvattgtsiaksievlrsngytvgt alvlvdrgegagellarmgvrlvsvatlktileklgwgge
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.238
    Matthews' coefficent 1.91 Rfactor 0.230
    Waters 338 Solvent Content 35.49

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 2yzk

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch