.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yzi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of uncharacterized conserved protein from Pyrococcus horikoshii. To be Published
    Site RSGI
    PDB Id 2yzi Target Id pho001000107.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13763, Molecular Weight 15250.16 Da.
    Residues 136 Isoelectric Point 8.01
    Sequence mdmkapikvymtkkllgvkpstsvqeasrlmmefdvgslvvinddgnvvgfftksdiirrvivpglpyd ipverimtrnlitanvntplgevlrkmaehrikhilieeegkivgiftlsdlleasrrrletaisae
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.25 Rfree 0.241
    Matthews' coefficent 2.07 Rfactor 0.228
    Waters 137 Solvent Content 40.56

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2yzi

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch