The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of peroxiredoxin-like protein from Aquifex aeolicus. to be published
    Site RSGI
    PDB Id 2yzh Target Id aae001000488.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12039, Molecular Weight 18765.83 Da.
    Residues 171 Isoelectric Point 4.94
    Sequence ghmartvnlkgnpvtlvgpelkvgdrapeavvvtkdlqekivggakdvvqviitvpsldtpvcetetkk fneimagmegvdvtvvsmdlpfaqkrfcesfniqnvtvasdfryrdmekygvligegalkgilaravfi idkegkvayvqlvpeiteepnydevvnkvkeli
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.85 Rfree 0.222
    Matthews' coefficent 2.23 Rfactor 0.192
    Waters 371 Solvent Content 44.81

    Ligand Information
    Ligands SO4 (SULFATE) x 4


    Google Scholar output for 2yzh

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch