.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yzg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of D-ALA:D-ALA Ligase from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2yzg Target Id ttk003001114.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14522, Molecular Weight 34664.07 Da.
    Residues 319 Isoelectric Point 4.97
    Sequence mrvlliaggvspehevsllsaegvlrhipfptdlaviaqdgrwllgekaltaleakaapegehpfpppl swerydvvfpllhgrfgedgtvqgflellgkpyvgagvaasalcmdkdlskrvlaqagvpvvpwvavrk geppvvpfdppffvkpantgssvgisrverfqdleaalalafrydekavvekalspvrelevgvlgnvf geaspvgevryeapfydyetkytpgraellipapldpgtqetvqelalkaykvlgvrgmarvdfflaeg elylnelntipgftptsmyprlfeaggvaypellrrlvelalt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.30 Rfree 0.290
    Matthews' coefficent 2.99 Rfactor 0.243
    Waters 204 Solvent Content 58.89

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2yzg

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch