The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the 32th Ig-like domain of human obscurin (KIAA1556). To be Published
    Site RSGI
    PDB Id 2yz8 Target Id hsk002001528.15
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12665, Molecular Weight 9786.64 Da.
    Residues 90 Isoelectric Point 8.25
    Sequence pvrfqealkdlevleggaatlrcvlssvaapvkwcygnnvlrpgdkyslrqegamlelvvrnlrpqdsg ryscsfgdqttsatltvtalp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.261
    Matthews' coefficent 2.22 Rfactor 0.209
    Waters 39 Solvent Content 44.56

    Ligand Information


    Google Scholar output for 2yz8

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch