.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yyo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal sturcture of human SPRY domain. To be Published
    Site RSGI
    PDB Id 2yyo Target Id hss001000898.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13223, Molecular Weight 17108.34 Da.
    Residues 158 Isoelectric Point 6.05
    Sequence fkhilvdgdtlsyhgnsgevgcyvasrpltkdsnyfevsivdsgvrgtiavglvpqyysldhqpgwlpd svayhaddgklyngrakgrqfgskcnsgdrigcgiepvsfdvqtaqifftkngkrvgstimpmspdglf pavgmhslgeevrlhlnael
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.261
    Matthews' coefficent 2.02 Rfactor 0.218
    Waters 91 Solvent Content 39.02

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2yyo

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch