.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yy8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure and mutational study of a unique SpoU family archaeal methylase that forms 2'-O-methylcytidine at position 56 of tRNA. J.Mol.Biol. 375 1064-1075 2008
    Site RSGI
    PDB Id 2yy8 Target Id pho001000461.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13822, Molecular Weight 22669.01 Da.
    Residues 202 Isoelectric Point 7.86
    Sequence mivvlrlghrperdkrvtthvaltarafgadgiiiaseedekvkesvedvvkrwggpffiefnrnwrkv mkeftgvkvhltmyglhvddvieelkeklkkgedfmiivgaekvprevyeladynvaignqphsevaal avlldrllegkglkkefkgakikivpqargkkvvevqgyaeqdkaegkatpgknwensgftgdn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.48 Rfree 0.268
    Matthews' coefficent 2.43 Rfactor 0.216
    Waters 101 Solvent Content 49.42

    Ligand Information
    Ligands MTA (5'-DEOXY-5'-METHYLTHIOADENOSINE) x 1;SAM (S-ADENOSYLMETHIONINE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2yy8

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch