The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the phosphoglycolate phosphatase from Aquifex aeolicus VF5. To be Published
    Site RSGI
    PDB Id 2yy6 Target Id aae001001342.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12064, Molecular Weight 23894.38 Da.
    Residues 213 Isoelectric Point 5.17
    Sequence mrvilfdldgtlidsakdialalektlkelgleeyypdnvtkyigggvrallekvlkdkfreeyvevfr khylenpvvytkpypeipytlealkskgfklavvsnkleelskkildilnlsgyfdlivggdtfgekkp sptpvlktleilgeepekalivgdtdadieagkragtktalalwgyvklnsqipdftlsrpsdlvklmd nhivef
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.276
    Matthews' coefficent 2.82 Rfactor 0.236
    Waters 191 Solvent Content 56.40

    Ligand Information
    Ligands SO4 (SULFATE) x 2


    Google Scholar output for 2yy6

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch