.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yy3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of translation elongation factor EF-1 beta from Pyrococcus horikoshii. To be Published
    Site RSGI
    PDB Id 2yy3 Target Id pho001030026.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS14027, Molecular Weight 10352.22 Da.
    Residues 91 Isoelectric Point 4.35
    Sequence msdfnlvgvirvmptdpdvnldeleeklkkvipekyglakverepiafglvalkfyvlgrdeegysfde vaekfeevenvesaevetvsri
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.50 Rfree 0.285
    Matthews' coefficent 3.55 Rfactor 0.236
    Waters 69 Solvent Content 65.36

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2yy3

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch