.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yy1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal sturcture of N-terminal domain of human galectin-9 containing L-acetyllactosamine. To be Published
    Site RSGI
    PDB Id 2yy1 Target Id hss001002697.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13303, Molecular Weight 16216.51 Da.
    Residues 147 Isoelectric Point 6.89
    Sequence mafsgsqapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgfsgndiafhfnprfedg gyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvmvngilfvqyfhrvpfhrvdtisvng svqlsyisf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.17 Rfree 0.244
    Matthews' coefficent 1.98 Rfactor 0.211
    Waters 63 Solvent Content 37.99

    Ligand Information
    Ligands NLC (2-(ACETYLAMINO)-2-DEOXY-4-O-BETA-D-GALACTOPYRANOSYL-) x 1
    Metals

    Jmol

     
    Google Scholar output for 2yy1

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch