The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of tt0281 from Thermus thermophilus HB8. to be published
    Site RSGI
    PDB Id 2yxz Target Id ttk003000281.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14318, Molecular Weight 32929.03 Da.
    Residues 311 Isoelectric Point 5.10
    Sequence mrlkdlgerallarlaplgyppeaplppgddaggvwaegrawllktdgflyrevalkgmgpfevgfrgv aatasdllakmgrplgftlglflpedleegfvlelvrgaaeaakrlgafllggdtnrgvevaltvsgya laeaplprkalpgdllylagdrwgrtgaairahyegrslegfpkireaafyplprlellalsgllrgsl dssdglaetlwqladlgvgvevealplypdvlafagseeaalelvlyggeefeavlvvpqegaaavear akakglplfragrvvagegvylrgaplprkgyahf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.90 Rfree 0.264
    Matthews' coefficent 2.41 Rfactor 0.225
    Waters 418 Solvent Content 48.89

    Ligand Information


    Google Scholar output for 2yxz

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch