.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yxy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystarl structure of Hypothetical conserved protein, GK0453. To be Published
    Site RSGI
    PDB Id 2yxy Target Id gka001000453.1
    Molecular Characteristics
    Source Geobacillus kaustophilus
    Alias Ids TPS12295, Molecular Weight 13089.51 Da.
    Residues 113 Isoelectric Point 6.62
    Sequence mikgeqkrysemtkeelqqeiamltekarkaeqmgmvneyavyerkiamakaymlnpadfhpgeiyeie gapgeyfkvrylkgvfawgwrlkgngeeealpisllrkpnlpqs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.263
    Matthews' coefficent 3.45 Rfactor 0.226
    Waters 170 Solvent Content 64.40

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2yxy

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch