.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yxx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure analysis of Diaminopimelate decarboxylate (lysA). To be Published
    Site RSGI
    PDB Id 2yxx Target Id tma001001517.1
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS14082, Molecular Weight 43979.40 Da.
    Residues 386 Isoelectric Point 6.83
    Sequence mdilrkvaeihgtptyvyfeetlrkrsrlvkevfegvnllptfavkannnpvllkilreegfgmdvvtk gellaaklagvpshtvvwngngksrdqmehflredvrivnvdsfeemeiwrelnpegveyfirvnpevd akthphistglkkhkfgipledldsfmerfrsmnirglhvhigsqitrvepfveafskvvraserygfe einigggwginysgeeldlssyrekvvpdlkrfkrviveigryivapsgylllrvvlvkrrhnkafvvv dggmnvlirpalysayhrifvlgkqgkemradvvgplcesgdviaydrelpevepgdiiavenagaygy tmsnnynsttrpaevlvrengrislirrretemdifkdvvm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.22
    Matthews' coefficent 2.65 Rfactor 0.189
    Waters 242 Solvent Content 53.52

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands PLP (PYRIDOXAL-5'-PHOSPHATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2yxx

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch