.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yxn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structual basis of azido-tyrosine recognition by engineered bacterial Tyrosyl-tRNA synthetase. To be Published
    Site RSGI
    PDB Id 2yxn Target Id ar_001000842.1
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS12222, Molecular Weight 35942.00 Da.
    Residues 322 Isoelectric Point 5.93
    Sequence massnlikqlqerglvaqvtdeealaerlaqgpialvcgfdptadslhlghlvpllclkrfqqaghkpv alvggatgligdpsfkaaerklnteetvqewvdkirkqvapfldfdcgensaiaannydwfgnmnvltf lrdigkhfsvnqminkeavkqrlnredqgisftefsynllqgydfaclnkqygvvlciggsdqwgnits gidltrrlhqnqvfgltvplitkadgtkfgkteggavwldpkktspykfyqfwintadadvyrflkfft fmsieeinaleeedknsgkapraqyvlaeqvtrlvhgeeglqaakr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.247
    Matthews' coefficent 2.60 Rfactor 0.199
    Waters 295 Solvent Content 52.64

    Ligand Information
    Ligands AZY (3-AZIDO-L-TYROSINE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2yxn

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch