.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yxl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of PH0851. To be Published
    Site RSGI
    PDB Id 2yxl Target Id pho001000851.2
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13947, Molecular Weight 22669.01 Da.
    Residues 202 Isoelectric Point 7.86
    Sequence mivvlrlghrperdkrvtthvaltarafgadgiiiaseedekvkesvedvvkrwggpffiefnrnwrkv mkeftgvkvhltmyglhvddvieelkeklkkgedfmiivgaekvprevyeladynvaignqphsevaal avlldrllegkglkkefkgakikivpqargkkvvevqgyaeqdkaegkatpgknwensgftgdn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.55 Rfree 0.24575
    Matthews' coefficent 3.55 Rfactor 0.2123
    Waters 58 Solvent Content 65.39

    Ligand Information
    Ligands SFG (ADENOSYL-ORNITHINE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2yxl

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch