.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yxa

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site RSGI
    PDB Id 2yxa Target Id aae001000841.3
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12047, Molecular Weight 45476.93 Da.
    Residues 392 Isoelectric Point 8.96
    Sequence meivqegiakiivpeipktvssdmpvfynprmrvnrdlavlgleylckklgrpvkvadplsasgirair flletscvekayandisskaieimkenfklnnipedryeihgmeanfflrkewgfgfdyvdldpfgtpv pfiesvalsmkrggilsltatdtaplsgtypktcmrrymarplrnefkhevgirilikkvielaaqydi amipifayshlhyfklffvkergvekvdklieqfgyiqycfncmnrevvtdlykfkekcphcgskfhig gplwigklwdeeftnflyeeaqkreeieketkrilklikeesqlqtvgfyvlsklaekvklpaqppiri avkffngvrthfvgdgfrtnlsfeevmkkmeelkekqkeflekkkqg
      BLAST   FFAS

    Structure Determination
    Method Chains
    Resolution (Å) Rfree
    Matthews' coefficent Rfactor
    Waters Solvent Content

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2yxa

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch