.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yx7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of glutamine receptor protein from Sulfolobus tokodaii strain 7 in complex with its effector L-glutamine: implications of effector binding in molecular association and DNA binding. Nucleic Acids Res. 36 4808-4820 2008
    Site RSGI
    PDB Id 2yx7 Target Id sto001001022.8
    Molecular Characteristics
    Source Sulfolobus tokodaii
    Alias Ids TPS14045, Molecular Weight 17473.58 Da.
    Residues 150 Isoelectric Point 9.11
    Sequence mdeidlrilkilqynakysldeiareiripkstlsyrikklekdgvikgyyayinpaslnldyivitsv kakygknyhvelgnklaqipgvwgvyfvlgdndfivmaryktreefmekflervmsipevertstqvvv kiikespnivif
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.05 Rfree 0.265
    Matthews' coefficent 2.87 Rfactor 0.238
    Waters 58 Solvent Content 57.15

    Ligand Information
    Ligands GLN x 1
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 2yx7

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch