.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yx1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of archaeal tRNA(m(1)G37)methyltransferase aTrm5. Proteins 72 1274-1289 2008
    Site RSGI
    PDB Id 2yx1 Target Id ar_001000741.1
    Molecular Characteristics
    Source Methanocaldococcus jannaschii
    Alias Ids TPS12213, Molecular Weight 38997.80 Da.
    Residues 336 Isoelectric Point 9.13
    Sequence mplclkinkkhgeqtrriliennllnkdykitsegnylylpikdvdedilksilniefelvdkeleekk iikkpsfreiiskkyrkeideglislsydvvgdlvilqisdevdekirkeigelayklipckgvfrrks evkgefrvrelehlagenrtltihkengyrlwvdiakvyfsprlggerarimkkvslndvvvdmfagvg pfsiacknakkiyaidinphaiellkkniklnklehkiipilsdvrevdvkgnrvimnlpkfahkfidk aldiveeggvihyytigkdfdkaiklfekkcdcevlekrivksyapreyilaldfkinkk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.276
    Matthews' coefficent 2.39 Rfactor 0.224
    Waters 253 Solvent Content 48.49

    Ligand Information
    Ligands SFG (ADENOSYL-ORNITHINE) x 2
    Metals ZN (ZINC) x 10

    Jmol

     
    Google Scholar output for 2yx1

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch