.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ywv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of SAICAR synthetase from Geobacillus kaustophilus. To be Published
    Site RSGI
    PDB Id 2ywv Target Id gka001000260.1
    Molecular Characteristics
    Source Geobacillus kaustophilus
    Alias Ids TPS12289, Molecular Weight 27287.83 Da.
    Residues 244 Isoelectric Point 5.56
    Sequence ghmptkqqllyegkakkiyatdepdvlwveykdsatafngekkatiagkgrlnneissllflklreagi anhfieklspteqlvrrvtiiplevvvrnvvagslakrigleegtpleaplvefyyknddlgdpllled hifilklasreevaalkqaalavndvlrlhfaernvrlidfklefgrtadgailladeispdtcrlwda ktnekldkdvfrrdlgsltdayevilqrlggesactk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.75 Rfree 0.191
    Matthews' coefficent 2.36 Rfactor 0.188
    Waters 525 Solvent Content 47.78

    Ligand Information
    Ligands SO4 (SULFATE) x 7;ADP (ADENOSINE-5'-DIPHOSPHATE) x 2
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 2ywv

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch