.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ywu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hypoxanthine-guanine phosphoribosyltransferase from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2ywu Target Id ttk003000125.3
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14234, Molecular Weight 20169.17 Da.
    Residues 181 Isoelectric Point 5.30
    Sequence mkgmftpgngpvqisaeaikkrveelggeiardyqgktphlicvlngafifmadlvraiplpltmdfia issygnafkssgevellkdlrlpihgrdvivvedivdtgltlsylldylearkpasvrvaallskpsrr qvevpihylgfeiedayvygygldraqfdrnlpfitsirpeee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.89 Rfree 0.230
    Matthews' coefficent 2.46 Rfactor 0.195
    Waters 186 Solvent Content 50.10

    Ligand Information
    Ligands IMP (INOSINIC) x 1;DIO (1,4-DIETHYLENE) x 2
    Metals

    Jmol

     
    Google Scholar output for 2ywu

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch