.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ywq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Thermus thermophilus Protein Y N-terminal domain. To be Published
    Site RSGI
    PDB Id 2ywq Target Id ttk003000785.3
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14433, Molecular Weight 12138.29 Da.
    Residues 105 Isoelectric Point 8.92
    Sequence mniykligrnleitdairdyvekklarldryqdgelmakvvlslagsphvekkaraeiqvdlpgglvrv eeedadlyaaidravdrletqvkrfrerryvgkrhs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.64 Rfree 0.294
    Matthews' coefficent 2.33 Rfactor 0.238
    Waters 39 Solvent Content 47.17

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ywq

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch