.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ywm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of glutaredoxin-like protein from Aquifex aeolicus. To be Published
    Site RSGI
    PDB Id 2ywm Target Id aae001000443.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12038, Molecular Weight 25639.22 Da.
    Residues 229 Isoelectric Point 4.74
    Sequence mllnldvrmqlkelaqkefkepvsiklfsqaigcescqtaeellketvevigeavgqdkikldiyspft hkeetekygvdrvptiviegdkdygiryiglpaglefttlingifhvsqrkpqlsektlellqvvdipi eiwvfvttscgycpsaavmawdfalandyitskvidasenqdlaeqfqvvgvpkivinkgvaefvgaqp enaflgyimavyeklkrekeqa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.30 Rfree 0.238
    Matthews' coefficent 4.61 Rfactor 0.22
    Waters 177 Solvent Content 73.31

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ywm

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch