.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ywd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of glutamine amidotransferase. To be Published
    Site RSGI
    PDB Id 2ywd Target Id ttk003001578.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14749, Molecular Weight 21208.33 Da.
    Residues 191 Isoelectric Point 5.83
    Sequence mrgvvgvlalqgdfrehkealkrlgieakevrkkehleglkalivpggesttigklareygiedevrkr veegslalfgtcagaiwlakeivgypeqprlgvleawvernafgrqvesfeedleveglgsfhgvfira pvfrrlgegvevlarlgdlpvlvrqgkvlassfhpeltedprlhryflelagv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.202
    Matthews' coefficent 2.79 Rfactor 0.187
    Waters 154 Solvent Content 55.97

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ywd

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch