.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yw9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of TT0143 from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2yw9 Target Id ttk003000143.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14248, Molecular Weight 28108.88 Da.
    Residues 261 Isoelectric Point 5.87
    Sequence mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealggallfradvtq deeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalevsayslvavarraepllre gggivtltyyasekvvpkynvmaiakaaleasvrylayelgpkgvrvnaisagpvrtvaarsipgftkm ydrvaqtaplrrnitqeevgnlglfllsplasgitgevvyvdagyhimgmeleg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.50 Rfree 0.26273
    Matthews' coefficent 2.11 Rfactor 0.22228
    Waters 386 Solvent Content 41.72

    Ligand Information
    Ligands NAP (NADP) x 2
    Metals

    Jmol

     
    Google Scholar output for 2yw9

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch