The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure Analysis of the 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3-deoxyphosphogluconate aldolase from TTHB1. To be published
    Site RSGI
    PDB Id 2yw3 Target Id ttk003002241.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14829, Molecular Weight 21721.11 Da.
    Residues 207 Isoelectric Point 5.58
    Sequence megmdplavlaesrllplltvrggedllglarvleeegvgaleitlrtekglealkalrksglllgagt vrspkeaeaaleagaaflvspglleevaalaqargvpylpgvltpteveralalglsalkffpaepfqg vrvlrayaevfpevrflptggikeehlphyaalpnllavggswllqgnleavrakvraakallspqapg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 1.67 Rfree 0.214
    Matthews' coefficent 2.83 Rfactor 0.182
    Waters 1023 Solvent Content 56.48

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 17


    Google Scholar output for 2yw3

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch